Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.0: automated matches [191561] (1 protein) not a true family |
Protein automated matches [190971] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188619] (3 PDB entries) |
Domain d2fh4c2: 2fh4 C:533-628 [133475] automated match to d1npha2 |
PDB Entry: 2fh4 (more details), 3 Å
SCOPe Domain Sequences for d2fh4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fh4c2 d.109.1.0 (C:533-628) automated matches {Human (Homo sapiens) [TaxId: 9606]} pastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaq ellrvlraqpvqvaegsepdgfwealggkaayrtsp
Timeline for d2fh4c2: