PDB entry 2fh4

View 2fh4 on RCSB PDB site
Description: C-terminal half of gelsolin soaked in EGTA at pH 8
Class: contractile protein
Keywords: gelsolin, EGTA, CONTRACTILE PROTEIN
Deposited on 2005-12-23, released 2006-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.219
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fh4A (A:)
    mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
    tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqt
    apastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektga
    qellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigr
    fvieevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanr
    drrtpitvvkqgfeppsfvgwflgwdddywsvdpldramaelaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fh4A (A:)
    mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
    tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsqtapas
    trlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaqell
    rvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmhpprlfacevpgelmqedla
    tddvmlldtwdqvfvwvgkdsqeeektealtsakryietdtpitvvkqgfeppsfvgwfl
    gwdddyw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fh4B (B:)
    mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
    tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqt
    apastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektga
    qellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigr
    fvieevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanr
    drrtpitvvkqgfeppsfvgwflgwdddywsvdpldramaelaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fh4B (B:)
    ddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrqgqiiynwqgaqstqdeva
    asailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtqtapastrlfqvr
    ansagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaqellrvlraqp
    vqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigrfvieevpgelm
    qedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanrdrrtpitvvkq
    gfeppsfvgwflgwdddyw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fh4C (C:)
    mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
    tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqt
    apastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektga
    qellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigr
    fvieevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanr
    drrtpitvvkqgfeppsfvgwflgwdddywsvdpldramaelaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fh4C (C:)
    ddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynygqiiynwqgaqstqdevaas
    ailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsqtapastrlfqvra
    nsagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaqellrvlraqpv
    qvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigrfvieevpgelmq
    edlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanrdrrtpitvvkqg
    feppsfvgwflgwdddyw