Lineage for d2fh4b3 (2fh4 B:629-741)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576227Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2576228Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2576507Family d.109.1.0: automated matches [191561] (1 protein)
    not a true family
  6. 2576508Protein automated matches [190971] (14 species)
    not a true protein
  7. 2576530Species Human (Homo sapiens) [TaxId:9606] [188619] (3 PDB entries)
  8. 2576537Domain d2fh4b3: 2fh4 B:629-741 [133473]
    automated match to d1npha3

Details for d2fh4b3

PDB Entry: 2fh4 (more details), 3 Å

PDB Description: c-terminal half of gelsolin soaked in egta at ph 8
PDB Compounds: (B:) gelsolin

SCOPe Domain Sequences for d2fh4b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fh4b3 d.109.1.0 (B:629-741) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlkdkkmdahpprlfacsnkigrfvieevpgelmqedlatddvmlldtwdqvfvwvgkds
qeeektealtsakryietdpanrdrrtpitvvkqgfeppsfvgwflgwdddyw

SCOPe Domain Coordinates for d2fh4b3:

Click to download the PDB-style file with coordinates for d2fh4b3.
(The format of our PDB-style files is described here.)

Timeline for d2fh4b3: