SCOPe 2.08: Domain d2fgra_: 2fgr A:

Lineage for d2fgra_ (2fgr A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.3: Porins [56935] (5 families)

5. Family f.4.3.1: Porin [56936] (2 proteins)
   trimer, one subunit folds into (16,20) barrel

6. Protein automated matches [190289] (7 species)
   not a true protein

7. Species Delftia acidovorans [TaxId:80866] [187093] (2 PDB entries)

8. Domain d2fgra_: 2fgr A: [133440]
   automated match to d1e54a_
   complexed with ca, so4

Details for d2fgra_

PDB Entry: 2fgr, 1.5 Å

PDB Description: High resolution Xray structure of Omp32

PDB Compounds: (A:) outer membrane porin protein 32

SCOPe Domain Sequences for d2fgra_:

Sequence; same for both SEQRES and ATOM records:

>d2fgra_ f.4.3.1 (A:) automated matches {Delftia acidovorans [TaxId: 80866]}
essvtlfgivdtnvayvnkdaagdsryglgtsgastsrlglrgtedlggglkagfwlege
ifgddgnasgfnfkrrstvslsgnfgevrlgrdlvptsqkltsydlfsatgigpfmgfrn
waagqgaddngirannlisyytpnfggfnagfgyafdekqtigtadsvgryiggyvaydn
gplsaslglaqqktavgglatdrdeitlgasynfgvaklsgllqqtkfkrdiggdiktns
ymlgasapvggvgevklqyalydqkaidskahqitlgyvhnlskrtalygnlaflknkda
stlglqakgvyaggvqagesqtgvqvgirhaf

Timeline for d2fgra_:

• d2fgra_ first appeared in SCOP 1.73, called d2fgra1
  
• d2fgra_ appears in SCOPe 2.07