SCOPe 2.04: Domain d2ffib_: 2ffi B:

Lineage for d2ffib_ (2ffi B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins)
   Pfam PF04909; Amidohydrolase; stand-alone domain

6. Protein Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 [141820] (1 species)

7. Species Pseudomonas putida [TaxId:303] [141821] (1 PDB entry)
   Uniprot Q88M75 10-280

8. Domain d2ffib_: 2ffi B: [133386]
   automated match to d2ffia1
   complexed with po4

Details for d2ffib_

PDB Entry: 2ffi, 2.61 Å

PDB Description: Crystal Structure of Putative 2-Pyrone-4,6-Dicarboxylic Acid Hydrolase from Pseudomonas putida, Northeast Structural Genomics Target PpR23.

PDB Compounds: (B:) 2-pyrone-4,6-dicarboxylic acid hydrolase, putative

SCOPe Domain Sequences for d2ffib_:

Sequence; same for both SEQRES and ATOM records:

>d2ffib_ c.1.9.15 (B:) Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 {Pseudomonas putida [TaxId: 303]}
lhltaidshahvfsrglnlasqrryapnydaplgdylgqlrahgfshgvlvqpsflgtdn
ryllsalqtvpgqlrgvvmlerdveqatlaemarlgvrgvrlnlmgqdmpdltgaqwrpl
lerigeqgwhvelhrqvadipvlvralqpygldividhfgrpdarrglgqpgfaelltls
grgkvwvkvsgiyrlqgspeenlafarqalcaleahygaerlmwgsdwphtqhesevsfg
saveqfealgcsaqlrqallldtaralfgfele

Timeline for d2ffib_:

• d2ffib_ first appeared in SCOP 1.73, called d2ffib1
  
• d2ffib_ appears in SCOPe 2.03
  
• d2ffib_ appears in SCOPe 2.05
  
• d2ffib_ appears in the current release, SCOPe 2.08, called d2ffib2