SCOP 1.73: Domain d2ffib1: 2ffi B:10-280

Lineage for d2ffib1 (2ffi B:10-280)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.15: PP1699/LP2961-like [141819] (5 proteins)
   Pfam PF04909; Amidohydrolase; stand-alone domain

6. Protein Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 [141820] (1 species)

7. Species Pseudomonas putida [TaxId:303] [141821] (1 PDB entry)

8. Domain d2ffib1: 2ffi B:10-280 [133386]
   automatically matched to 2FFI A:10-280
   complexed with po4

Details for d2ffib1

PDB Entry: 2ffi, 2.61 Å

PDB Description: Crystal Structure of Putative 2-Pyrone-4,6-Dicarboxylic Acid Hydrolase from Pseudomonas putida, Northeast Structural Genomics Target PpR23.

PDB Compounds: (B:) 2-pyrone-4,6-dicarboxylic acid hydrolase, putative

SCOP Domain Sequences for d2ffib1:

Sequence; same for both SEQRES and ATOM records:

>d2ffib1 c.1.9.15 (B:10-280) Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 {Pseudomonas putida [TaxId: 303]}
lhltaidshahvfsrglnlasqrryapnydaplgdylgqlrahgfshgvlvqpsflgtdn
ryllsalqtvpgqlrgvvmlerdveqatlaemarlgvrgvrlnlmgqdmpdltgaqwrpl
lerigeqgwhvelhrqvadipvlvralqpygldividhfgrpdarrglgqpgfaelltls
grgkvwvkvsgiyrlqgspeenlafarqalcaleahygaerlmwgsdwphtqhesevsfg
saveqfealgcsaqlrqallldtaralfgfe

Timeline for d2ffib1:

• d2ffib1 is new in SCOP 1.73
  
• d2ffib1 appears in SCOP 1.75
  
• d2ffib1 appears in the current release, SCOPe 2.08, called d2ffib2