Lineage for d2ff7a_ (2ff7 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1165644Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 1165747Protein Haemolysin B ATP-binding protein [89683] (1 species)
  7. 1165748Species Escherichia coli [TaxId:562] [89684] (3 PDB entries)
  8. 1165750Domain d2ff7a_: 2ff7 A: [133377]
    automated match to d2pmka1
    complexed with adp

Details for d2ff7a_

PDB Entry: 2ff7 (more details), 1.6 Å

PDB Description: The ABC-ATPase of the ABC-transporter HlyB in the ADP bound state
PDB Compounds: (A:) Alpha-hemolysin translocation ATP-binding protein hlyB

SCOPe Domain Sequences for d2ff7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ff7a_ c.37.1.12 (A:) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}
hhditfrnirfrykpdspvildninlsikqgevigivgrsgsgkstltkliqrfyipeng
qvlidghdlaladpnwlrrqvgvvlqdnvllnrsiidnislanpgmsvekviyaaklaga
hdfiselregyntivgeqgaglsggqrqriaiaralvnnpkilifdeatsaldyesehvi
mrnmhkickgrtviiiahrlstvknadriivmekgkiveqgkhkellsepeslysylyql
qsd

SCOPe Domain Coordinates for d2ff7a_:

Click to download the PDB-style file with coordinates for d2ff7a_.
(The format of our PDB-style files is described here.)

Timeline for d2ff7a_: