SCOPe 2.08: Domain d2ff7a2: 2ff7 A:467-707

Lineage for d2ff7a2 (2ff7 A:467-707)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein Haemolysin B ATP-binding protein [89683] (1 species)

7. Species Escherichia coli [TaxId:562] [89684] (3 PDB entries)

8. Domain d2ff7a2: 2ff7 A:467-707 [133377]
   Other proteins in same PDB: d2ff7a3
   automated match to d2pmka1
   complexed with adp

Details for d2ff7a2

PDB Entry: 2ff7, 1.6 Å

PDB Description: The ABC-ATPase of the ABC-transporter HlyB in the ADP bound state

PDB Compounds: (A:) Alpha-hemolysin translocation ATP-binding protein hlyB

SCOPe Domain Sequences for d2ff7a2:

Sequence; same for both SEQRES and ATOM records:

>d2ff7a2 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}
ditfrnirfrykpdspvildninlsikqgevigivgrsgsgkstltkliqrfyipengqv
lidghdlaladpnwlrrqvgvvlqdnvllnrsiidnislanpgmsvekviyaaklagahd
fiselregyntivgeqgaglsggqrqriaiaralvnnpkilifdeatsaldyesehvimr
nmhkickgrtviiiahrlstvknadriivmekgkiveqgkhkellsepeslysylyqlqs
d

Timeline for d2ff7a2:

• d2ff7a2 first appeared in SCOP 1.73, called d2ff7a1
  
• d2ff7a2 appears in SCOPe 2.07