![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
![]() | Protein Haemolysin B ATP-binding protein [89683] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [89684] (3 PDB entries) |
![]() | Domain d2ff7a2: 2ff7 A:467-707 [133377] Other proteins in same PDB: d2ff7a3 automated match to d2pmka1 complexed with adp |
PDB Entry: 2ff7 (more details), 1.6 Å
SCOPe Domain Sequences for d2ff7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ff7a2 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} ditfrnirfrykpdspvildninlsikqgevigivgrsgsgkstltkliqrfyipengqv lidghdlaladpnwlrrqvgvvlqdnvllnrsiidnislanpgmsvekviyaaklagahd fiselregyntivgeqgaglsggqrqriaiaralvnnpkilifdeatsaldyesehvimr nmhkickgrtviiiahrlstvknadriivmekgkiveqgkhkellsepeslysylyqlqs d
Timeline for d2ff7a2: