Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein Haemolysin B ATP-binding protein [89683] (1 species) |
Species Escherichia coli [TaxId:562] [89684] (3 PDB entries) |
Domain d2ff7a_: 2ff7 A: [133377] automated match to d2pmka1 complexed with adp |
PDB Entry: 2ff7 (more details), 1.6 Å
SCOPe Domain Sequences for d2ff7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ff7a_ c.37.1.12 (A:) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} hhditfrnirfrykpdspvildninlsikqgevigivgrsgsgkstltkliqrfyipeng qvlidghdlaladpnwlrrqvgvvlqdnvllnrsiidnislanpgmsvekviyaaklaga hdfiselregyntivgeqgaglsggqrqriaiaralvnnpkilifdeatsaldyesehvi mrnmhkickgrtviiiahrlstvknadriivmekgkiveqgkhkellsepeslysylyql qsd
Timeline for d2ff7a_: