Lineage for d2feza2 (2fez A:105-283)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726835Family a.118.8.3: BTAD-like [140845] (1 protein)
    Pfam PF03704; Bacterial transcriptional activator domain
  6. 2726836Protein Probable regulatory protein EmbR, middle domain [140846] (1 species)
  7. 2726837Species Mycobacterium tuberculosis [TaxId:1773] [140847] (2 PDB entries)
    Uniprot P66799 105-283
  8. 2726840Domain d2feza2: 2fez A:105-283 [133358]
    Other proteins in same PDB: d2feza1, d2feza3

Details for d2feza2

PDB Entry: 2fez (more details), 2 Å

PDB Description: Mycobacterium tuberculosis EmbR
PDB Compounds: (A:) Probable regulatory protein embR

SCOPe Domain Sequences for d2feza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2feza2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}
ipdntcdlgrfvaektagvhaaaagrfeqasrhlsaalrewrgpvlddlrdfqfvepfat
alvedkvlahtakaeaeiacgrasaviaelealtfehpyreplwtqlitayylsdrqsda
lgayrrvkttladdlgidpgptlralnerilrqqpldakksakttaagtvtvldqrtma

SCOPe Domain Coordinates for d2feza2:

Click to download the PDB-style file with coordinates for d2feza2.
(The format of our PDB-style files is described here.)

Timeline for d2feza2: