| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
| Family a.4.6.1: PhoB-like [46895] (6 proteins) contains 4-stranded meander beta-sheet in the N-terminal extension |
| Protein Probable regulatory protein EmbR [140313] (1 species) N-terminal domain, unlike the other members |
| Species Mycobacterium tuberculosis [TaxId:1773] [140314] (2 PDB entries) Uniprot P66799 10-104 |
| Domain d2feza1: 2fez A:10-104 [133357] Other proteins in same PDB: d2feza2, d2feza3 |
PDB Entry: 2fez (more details), 2 Å
SCOPe Domain Sequences for d2feza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2feza1 a.4.6.1 (A:10-104) Probable regulatory protein EmbR {Mycobacterium tuberculosis [TaxId: 1773]}
rldfgllgplqmtidgtpvpsgtpkqravlamlvinrnrpvgvdalitalweewppsgar
asihsyvsnlrkllggagidprvvlaaappgyrls
Timeline for d2feza1: