SCOPe 2.07: Domain d2fdob2: 2fdo B:1-92

Lineage for d2fdob2 (2fdo B:1-92)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.337: AF2331-like [143994] (1 superfamily)
   interlocked dimer of beta-alpha-beta(2)-alpha-beta-(alpha) subunits; 3 layers: b/b/a

4. Superfamily d.337.1: AF2331-like [143995] (1 family)

5. Family d.337.1.1: AF2331-like [143996] (1 protein)

6. Protein Hypothetical protein AF2331 [143997] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [143998] (1 PDB entry)
   Uniprot O27953 1-92

8. Domain d2fdob2: 2fdo B:1-92 [133315]
   Other proteins in same PDB: d2fdoa2, d2fdob3
   automated match to d2fdoa1

Details for d2fdob2

PDB Entry: 2fdo, 2.4 Å

PDB Description: crystal structure of the conserved protein of unknown function af2331 from archaeoglobus fulgidus dsm 4304 reveals a new type of alpha/beta fold

PDB Compounds: (B:) Hypothetical protein AF2331

SCOPe Domain Sequences for d2fdob2:

Sequence; same for both SEQRES and ATOM records:

>d2fdob2 d.337.1.1 (B:1-92) Hypothetical protein AF2331 {Archaeoglobus fulgidus [TaxId: 2234]}
mpayvfskesflkfleghleddvvvvvssdvtdfckklsesmvgekeycfaefafpadif
dadedeidemmkyaivfvekeklseagrnair

Timeline for d2fdob2:

• d2fdob2 first appeared in SCOP 1.73, called d2fdob1
  
• d2fdob2 appears in SCOPe 2.06
  
• d2fdob2 appears in the current release, SCOPe 2.08