PDB entry 2fdo

View 2fdo on RCSB PDB site
Description: Crystal Structure of the Conserved Protein of Unknown Function AF2331 from Archaeoglobus fulgidus DSM 4304 Reveals a New Type of Alpha/Beta Fold
Class: Structural genomics, unknown function
Keywords: X-ray Crystallography; Multiwavelength anomalous dispersion; Conserved hypothetical protein; Archaeoglobus fulgidus; New type of alpha/beta fold, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2005-12-14, released 2006-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.201
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein AF2331
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: af2331
    Database cross-references and differences (RAF-indexed):
    • Uniprot O27953 (2-93)
      • cloning artifact (1)
      • modified residue (2)
      • modified residue (43)
      • modified residue (71-72)
    Domains in SCOPe 2.07: d2fdoa1, d2fdoa2
  • Chain 'B':
    Compound: Hypothetical protein AF2331
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: af2331
    Database cross-references and differences (RAF-indexed):
    • Uniprot O27953 (2-93)
      • cloning artifact (0-1)
      • modified residue (2)
      • modified residue (43)
      • modified residue (71-72)
    Domains in SCOPe 2.07: d2fdob2, d2fdob3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2fdoA (A:)
ghmpayvfskesflkfleghleddvvvvvssdvtdfckklsesmvgekeycfaefafpad
ifdadedeidemmkyaivfvekeklseagrnair

    Sequence, based on observed residues (ATOM records): (download) 
    >2fdoA (A:)
hmpayvfskesflkfleghleddvvvvvssdvtdfckklsesmvgekeycfaefafpadi
fdadedeidemmkyaivfvekeklseagrnair

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fdoB (B:)
ghmpayvfskesflkfleghleddvvvvvssdvtdfckklsesmvgekeycfaefafpad
ifdadedeidemmkyaivfvekeklseagrnair