![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.337: AF2331-like [143994] (1 superfamily) interlocked dimer of beta-alpha-beta(2)-alpha-beta-(alpha) subunits; 3 layers: b/b/a |
![]() | Superfamily d.337.1: AF2331-like [143995] (1 family) ![]() |
![]() | Family d.337.1.1: AF2331-like [143996] (1 protein) |
![]() | Protein Hypothetical protein AF2331 [143997] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [143998] (1 PDB entry) Uniprot O27953 1-92 |
![]() | Domain d2fdob2: 2fdo B:1-92 [133315] Other proteins in same PDB: d2fdoa2, d2fdob3 automated match to d2fdoa1 |
PDB Entry: 2fdo (more details), 2.4 Å
SCOPe Domain Sequences for d2fdob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fdob2 d.337.1.1 (B:1-92) Hypothetical protein AF2331 {Archaeoglobus fulgidus [TaxId: 2234]} mpayvfskesflkfleghleddvvvvvssdvtdfckklsesmvgekeycfaefafpadif dadedeidemmkyaivfvekeklseagrnair
Timeline for d2fdob2: