| Class k: Designed proteins [58788] (44 folds) |
| Fold k.45: Ubiquitin [144344] (1 superfamily) |
Superfamily k.45.1: Ubiquitin [144345] (1 family) ![]() |
| Family k.45.1.1: Ubiquitin [144346] (1 protein) |
| Protein Ubiquitin [144347] (1 species) |
| Species Synthetic [144348] (6 PDB entries) |
| Domain d2fcqb1: 2fcq B:1-59 [133279] Other proteins in same PDB: d2fcqa2, d2fcqb2 automatically matched to 1YIW A:1-71 complexed with cd |
PDB Entry: 2fcq (more details), 3.3 Å
SCOPe Domain Sequences for d2fcqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fcqb1 k.45.1.1 (B:1-59) Ubiquitin {Synthetic}
lqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy
Timeline for d2fcqb1: