Lineage for d2fcqb1 (2fcq B:1-71)

  1. Root: SCOP 1.73
  2. 757717Class k: Designed proteins [58788] (44 folds)
  3. 758306Fold k.45: Ubiquitin [144344] (1 superfamily)
  4. 758307Superfamily k.45.1: Ubiquitin [144345] (1 family) (S)
  5. 758308Family k.45.1.1: Ubiquitin [144346] (1 protein)
  6. 758309Protein Ubiquitin [144347] (1 species)
  7. 758310Species synthetic [144348] (6 PDB entries)
  8. 758324Domain d2fcqb1: 2fcq B:1-71 [133279]
    automatically matched to 1YIW A:1-71

Details for d2fcqb1

PDB Entry: 2fcq (more details), 3.3 Å

PDB Description: x-ray crystal structure of a chemically synthesized ubiquitin with a cubic space group
PDB Compounds: (B:) Ubiquitin

SCOP Domain Sequences for d2fcqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcqb1 k.45.1.1 (B:1-71) Ubiquitin {synthetic}
lqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvl

SCOP Domain Coordinates for d2fcqb1:

Click to download the PDB-style file with coordinates for d2fcqb1.
(The format of our PDB-style files is described here.)

Timeline for d2fcqb1: