Lineage for d2fcqb1 (2fcq B:1-71)

  1. Root: SCOPe 2.05
  2. 1975766Class k: Designed proteins [58788] (44 folds)
  3. 1976383Fold k.45: Ubiquitin [144344] (1 superfamily)
  4. 1976384Superfamily k.45.1: Ubiquitin [144345] (1 family) (S)
  5. 1976385Family k.45.1.1: Ubiquitin [144346] (1 protein)
  6. 1976386Protein Ubiquitin [144347] (1 species)
  7. 1976387Species Synthetic [144348] (6 PDB entries)
  8. 1976401Domain d2fcqb1: 2fcq B:1-71 [133279]
    automatically matched to 1YIW A:1-71
    complexed with cd

Details for d2fcqb1

PDB Entry: 2fcq (more details), 3.3 Å

PDB Description: x-ray crystal structure of a chemically synthesized ubiquitin with a cubic space group
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d2fcqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcqb1 k.45.1.1 (B:1-71) Ubiquitin {Synthetic}
lqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvl

SCOPe Domain Coordinates for d2fcqb1:

Click to download the PDB-style file with coordinates for d2fcqb1.
(The format of our PDB-style files is described here.)

Timeline for d2fcqb1:

1976401
d2fcqb1 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d2fcqa1