Lineage for d2fcea_ (2fce A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710608Protein Calmodulin [47516] (13 species)
  7. 2710634Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89052] (4 PDB entries)
  8. 2710635Domain d2fcea_: 2fce A: [133266]
    automated match to d1xfxo1
    fragment; missing more than one-third of the common structure and/or sequence

Details for d2fcea_

PDB Entry: 2fce (more details)

PDB Description: solution structure of c-lobe myosin light chain from saccharomices cerevisiae
PDB Compounds: (A:) myosin light chain 1

SCOPe Domain Sequences for d2fcea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcea_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaktedfvkafqvfdkestgkvsvgdlrymltglgekltdaevdellkgvevdsngeidy
kkfiedvlrq

SCOPe Domain Coordinates for d2fcea_:

Click to download the PDB-style file with coordinates for d2fcea_.
(The format of our PDB-style files is described here.)

Timeline for d2fcea_: