Lineage for d2f9tb1 (2f9t B:115-247)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605994Family c.55.1.13: CoaX-like [142484] (1 protein)
    Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf
  6. 1605995Protein Type III pantothenate kinase, CoaX [142485] (3 species)
  7. 1606001Species Pseudomonas aeruginosa [TaxId:287] [142487] (2 PDB entries)
    Uniprot Q9HWC1 1-114! Uniprot Q9HWC1 115-248
  8. 1606008Domain d2f9tb1: 2f9t B:115-247 [133172]
    automated match to d2f9ta1

Details for d2f9tb1

PDB Entry: 2f9t (more details), 2.2 Å

PDB Description: Structure of the type III CoaA from Pseudomonas aeruginosa
PDB Compounds: (B:) pantothenate kinase

SCOPe Domain Sequences for d2f9tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f9tb1 c.55.1.13 (B:115-247) Type III pantothenate kinase, CoaX {Pseudomonas aeruginosa [TaxId: 287]}
kaclvidlgtavtsdlvaadgvhlggyicpgmtlmrsqlrthtrriryddaearralasl
qpgqataeavergcllmlrgfvreqyamacellgpdceifltggdaelvrdelagarimp
dlvfvglalacpi

SCOPe Domain Coordinates for d2f9tb1:

Click to download the PDB-style file with coordinates for d2f9tb1.
(The format of our PDB-style files is described here.)

Timeline for d2f9tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f9tb2