| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.13: CoaX-like [142484] (1 protein) Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf |
| Protein Type III pantothenate kinase, CoaX [142485] (3 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [142487] (2 PDB entries) Uniprot Q9HWC1 1-114! Uniprot Q9HWC1 115-248 |
| Domain d2f9ta2: 2f9t A:1-114 [133171] |
PDB Entry: 2f9t (more details), 2.2 Å
SCOPe Domain Sequences for d2f9ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f9ta2 c.55.1.13 (A:1-114) Type III pantothenate kinase, CoaX {Pseudomonas aeruginosa [TaxId: 287]}
mileldcgnslikwrviegaarsvagglaesddalveqltsqqalpvracrlvsvrseqe
tsqlvarleqlfpvsalvassgkqlagvrngyldyqrlgldrwlalvaahhlak
Timeline for d2f9ta2: