Lineage for d2f9ta2 (2f9t A:1-114)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373251Family c.55.1.13: CoaX-like [142484] (1 protein)
    Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf
  6. 1373252Protein Type III pantothenate kinase, CoaX [142485] (3 species)
  7. 1373258Species Pseudomonas aeruginosa [TaxId:287] [142487] (2 PDB entries)
    Uniprot Q9HWC1 1-114! Uniprot Q9HWC1 115-248
  8. 1373264Domain d2f9ta2: 2f9t A:1-114 [133171]

Details for d2f9ta2

PDB Entry: 2f9t (more details), 2.2 Å

PDB Description: Structure of the type III CoaA from Pseudomonas aeruginosa
PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d2f9ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f9ta2 c.55.1.13 (A:1-114) Type III pantothenate kinase, CoaX {Pseudomonas aeruginosa [TaxId: 287]}
mileldcgnslikwrviegaarsvagglaesddalveqltsqqalpvracrlvsvrseqe
tsqlvarleqlfpvsalvassgkqlagvrngyldyqrlgldrwlalvaahhlak

SCOPe Domain Coordinates for d2f9ta2:

Click to download the PDB-style file with coordinates for d2f9ta2.
(The format of our PDB-style files is described here.)

Timeline for d2f9ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f9ta1