Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) duplication contains two domains of this fold |
Family c.55.1.13: CoaX-like [142484] (1 protein) Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf |
Protein Type III pantothenate kinase, CoaX [142485] (3 species) |
Species Pseudomonas aeruginosa [TaxId:287] [142487] (2 PDB entries) |
Domain d2f9tb1: 2f9t B:115-247 [133172] automatically matched to 2F9T A:115-248 |
PDB Entry: 2f9t (more details), 2.2 Å
SCOP Domain Sequences for d2f9tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f9tb1 c.55.1.13 (B:115-247) Type III pantothenate kinase, CoaX {Pseudomonas aeruginosa [TaxId: 287]} kaclvidlgtavtsdlvaadgvhlggyicpgmtlmrsqlrthtrriryddaearralasl qpgqataeavergcllmlrgfvreqyamacellgpdceifltggdaelvrdelagarimp dlvfvglalacpi
Timeline for d2f9tb1: