Lineage for d2f8fb1 (2f8f B:85-205)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1492203Protein automated matches [226848] (10 species)
    not a true protein
  7. Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [225081] (4 PDB entries)
  8. 1492209Domain d2f8fb1: 2f8f B:85-205 [133124]
    Other proteins in same PDB: d2f8fa2, d2f8fb2
    automated match to d1u3ia2
    complexed with gsh; mutant

Details for d2f8fb1

PDB Entry: 2f8f (more details), 2.1 Å

PDB Description: crystal structure of the y10f mutant of the gluathione s-transferase from schistosoma haematobium
PDB Compounds: (B:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d2f8fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8fb1 a.45.1.1 (B:85-205) automated matches {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk
astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls
d

SCOPe Domain Coordinates for d2f8fb1:

Click to download the PDB-style file with coordinates for d2f8fb1.
(The format of our PDB-style files is described here.)

Timeline for d2f8fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f8fb2