Lineage for d2f8fa2 (2f8f A:4-84)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [225080] (4 PDB entries)
  8. 1602523Domain d2f8fa2: 2f8f A:4-84 [133123]
    Other proteins in same PDB: d2f8fa1, d2f8fb1
    automated match to d1u3ia1
    complexed with gsh; mutant

Details for d2f8fa2

PDB Entry: 2f8f (more details), 2.1 Å

PDB Description: crystal structure of the y10f mutant of the gluathione s-transferase from schistosoma haematobium
PDB Compounds: (A:) glutathione s-transferase 28 kda

SCOPe Domain Sequences for d2f8fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8fa2 c.47.1.0 (A:4-84) automated matches {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
dhikviffngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
hvkwmveslaiarymakkhhm

SCOPe Domain Coordinates for d2f8fa2:

Click to download the PDB-style file with coordinates for d2f8fa2.
(The format of our PDB-style files is described here.)

Timeline for d2f8fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f8fa1