Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) |
Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
Protein Sh3 and multiple ankyrin repeat domains 3 (Shank3) [140616] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [140617] (2 PDB entries) Uniprot Q9JLU4 1749-1815 |
Domain d2f44c_: 2f44 C: [132913] automated match to d2f3na1 complexed with cl, zn |
PDB Entry: 2f44 (more details), 2.4 Å
SCOPe Domain Sequences for d2f44c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f44c_ a.60.1.2 (C:) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Norway rat (Rattus norvegicus) [TaxId: 10116]} lqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghreniera lr
Timeline for d2f44c_: