SCOPe 2.07: Domain d2f06b1: 2f06 B:71-141

Lineage for d2f06b1 (2f06 B:71-141)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.11: BT0572-like [143395] (1 protein)
   duplication: tandem repeat of two ACT-like domains; dimerizes with the formation of orthogonally packed intersubunit beta-sheets

6. Protein Hypothetical protein BT0572 [143396] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [143397] (1 PDB entry)
   Uniprot Q8AA93 1-70! Uniprot Q8AA93 71-141

8. Domain d2f06b1: 2f06 B:71-141 [132654]
   Other proteins in same PDB: d2f06a3, d2f06b3
   automated match to d2f06a1
   complexed with his

Details for d2f06b1

PDB Entry: 2f06, 2.1 Å

PDB Description: Crystal structure of protein BT0572 from Bacteroides thetaiotaomicron

PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d2f06b1:

Sequence; same for both SEQRES and ATOM records:

>d2f06b1 d.58.18.11 (B:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]}
vvgiscpnvpgalakvlgflsaegvfieymysfannnvanvvirpsnmdkcievlkekkv
dllaasdlykl

Timeline for d2f06b1:

• d2f06b1 first appeared in SCOP 1.73
  
• d2f06b1 appears in SCOPe 2.06
  
• d2f06b1 appears in the current release, SCOPe 2.08