Lineage for d2f06b2 (2f06 B:1-70)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560919Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2561091Family d.58.18.11: BT0572-like [143395] (1 protein)
    duplication: tandem repeat of two ACT-like domains; dimerizes with the formation of orthogonally packed intersubunit beta-sheets
  6. 2561092Protein Hypothetical protein BT0572 [143396] (1 species)
  7. 2561093Species Bacteroides thetaiotaomicron [TaxId:818] [143397] (1 PDB entry)
    Uniprot Q8AA93 1-70! Uniprot Q8AA93 71-141
  8. 2561097Domain d2f06b2: 2f06 B:1-70 [132655]
    Other proteins in same PDB: d2f06a3, d2f06b3
    automated match to d2f06a2
    complexed with his

Details for d2f06b2

PDB Entry: 2f06 (more details), 2.1 Å

PDB Description: Crystal structure of protein BT0572 from Bacteroides thetaiotaomicron
PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d2f06b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f06b2 d.58.18.11 (B:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]}
mvakqlsiflenksgrltevtevlakeninlsalciaenadfgilrgivsdpdkaykalk
dnhfavnitd

SCOPe Domain Coordinates for d2f06b2:

Click to download the PDB-style file with coordinates for d2f06b2.
(The format of our PDB-style files is described here.)

Timeline for d2f06b2: