Lineage for d2f06b1 (2f06 B:71-141)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. Family d.58.18.11: BT0572-like [143395] (1 protein)
    duplication: tandem repeat of two ACT-like domains; dimerizes with the formation of orthogonally packed intersubunit beta-sheets
  6. Protein Hypothetical protein BT0572 [143396] (1 species)
  7. Species Bacteroides thetaiotaomicron [TaxId:818] [143397] (1 PDB entry)
    Uniprot Q8AA93 1-70! Uniprot Q8AA93 71-141
  8. Domain d2f06b1: 2f06 B:71-141 [132654]
    Other proteins in same PDB: d2f06a3, d2f06b3
    automated match to d2f06a1
    complexed with his

Details for d2f06b1

PDB Entry: 2f06 (more details), 2.1 Å

PDB Description: Crystal structure of protein BT0572 from Bacteroides thetaiotaomicron
PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d2f06b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f06b1 d.58.18.11 (B:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]}
vvgiscpnvpgalakvlgflsaegvfieymysfannnvanvvirpsnmdkcievlkekkv
dllaasdlykl

SCOPe Domain Coordinates for d2f06b1 are not available.

Timeline for d2f06b1:

Domains from same chain:
(mouse over for more information)
d2f06b2, d2f06b3
Domains from other chains:
(mouse over for more information)
d2f06a1, d2f06a2, d2f06a3