SCOPe 2.08: Domain d2ezwa1: 2ezw A:12-61

Lineage for d2ezwa1 (2ezw A:12-61)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)

6. Protein cAMP-dependent protein kinase type I-alpha regulatory subunit [140510] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [140511] (3 PDB entries)
   Uniprot P00514 12-61

8. Domain d2ezwa1: 2ezw A:12-61 [132645]

Details for d2ezwa1

PDB Entry: 2ezw

PDB Description: solution structure of the docking and dimerization domain of the type i alpha regulatory subunit of protein kinase a (rialpha d/d)

PDB Compounds: (A:) cAMP-dependent protein kinase type I-alpha regulatory subunit

SCOPe Domain Sequences for d2ezwa1:

Sequence; same for both SEQRES and ATOM records:

>d2ezwa1 a.31.1.1 (A:12-61) cAMP-dependent protein kinase type I-alpha regulatory subunit {Cow (Bos taurus) [TaxId: 9913]}
slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeeak

Timeline for d2ezwa1:

• d2ezwa1 first appeared in SCOP 1.73
  
• d2ezwa1 appears in SCOPe 2.07