Lineage for d2ezwa1 (2ezw A:12-61)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709186Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 2709187Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) (S)
    dimer of identical alpha-hairpin motifs
  5. 2709188Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)
  6. 2709189Protein cAMP-dependent protein kinase type I-alpha regulatory subunit [140510] (1 species)
  7. 2709190Species Cow (Bos taurus) [TaxId:9913] [140511] (3 PDB entries)
    Uniprot P00514 12-61
  8. 2709194Domain d2ezwa1: 2ezw A:12-61 [132645]

Details for d2ezwa1

PDB Entry: 2ezw (more details)

PDB Description: solution structure of the docking and dimerization domain of the type i alpha regulatory subunit of protein kinase a (rialpha d/d)
PDB Compounds: (A:) cAMP-dependent protein kinase type I-alpha regulatory subunit

SCOPe Domain Sequences for d2ezwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezwa1 a.31.1.1 (A:12-61) cAMP-dependent protein kinase type I-alpha regulatory subunit {Cow (Bos taurus) [TaxId: 9913]}
slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeeak

SCOPe Domain Coordinates for d2ezwa1:

Click to download the PDB-style file with coordinates for d2ezwa1.
(The format of our PDB-style files is described here.)

Timeline for d2ezwa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ezwb_