Class a: All alpha proteins [46456] (290 folds) |
Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily) 4 helices; bundle, closed, right-handed twist |
Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) dimer of identical alpha-hairpin motifs |
Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins) |
Protein cAMP-dependent protein kinase type I-alpha regulatory subunit [140510] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [140511] (3 PDB entries) Uniprot P00514 12-61 |
Domain d2ezwa1: 2ezw A:12-61 [132645] |
PDB Entry: 2ezw (more details)
SCOPe Domain Sequences for d2ezwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ezwa1 a.31.1.1 (A:12-61) cAMP-dependent protein kinase type I-alpha regulatory subunit {Cow (Bos taurus) [TaxId: 9913]} slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeeak
Timeline for d2ezwa1: