PDB entry 2ezw

View 2ezw on RCSB PDB site
Description: Solution structure of the docking and dimerization domain of the type I alpha regulatory subunit of protein kinase A (RIalpha D/D)
Class: transferase
Keywords: regulatory subunit, anchoring, four-helix bundle, transferase
Deposited on 2005-11-10, released 2006-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase type I-alpha regulatory subunit
    Species: Bos taurus [TaxId:9913]
    Gene: PRKAR1A (amino acids:12 - 61)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ezwa1
  • Chain 'B':
    Compound: cAMP-dependent protein kinase type I-alpha regulatory subunit
    Species: Bos taurus [TaxId:9913]
    Gene: PRKAR1A (amino acids:12 - 61)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ezwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ezwA (A:)
    slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeeak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ezwB (B:)
    slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeeak