SCOPe 2.08: Domain d2ezwb_: 2ezw B:

Lineage for d2ezwb_ (2ezw B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)

6. Protein cAMP-dependent protein kinase type I-alpha regulatory subunit [140510] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [140511] (3 PDB entries)
   Uniprot P00514 12-61

8. Domain d2ezwb_: 2ezw B: [132646]
   automated match to d3im3a_

Details for d2ezwb_

PDB Entry: 2ezw

PDB Description: solution structure of the docking and dimerization domain of the type i alpha regulatory subunit of protein kinase a (rialpha d/d)

PDB Compounds: (B:) cAMP-dependent protein kinase type I-alpha regulatory subunit

SCOPe Domain Sequences for d2ezwb_:

Sequence; same for both SEQRES and ATOM records:

>d2ezwb_ a.31.1.1 (B:) cAMP-dependent protein kinase type I-alpha regulatory subunit {Cow (Bos taurus) [TaxId: 9913]}
slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeeak

Timeline for d2ezwb_:

• d2ezwb_ first appeared in SCOP 1.73, called d2ezwb1
  
• d2ezwb_ appears in SCOPe 2.07