Lineage for d2ezwb_ (2ezw B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318626Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 2318627Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) (S)
    dimer of identical alpha-hairpin motifs
  5. 2318628Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 protein domains)
  6. 2318629Protein cAMP-dependent protein kinase type I-alpha regulatory subunit [140510] (1 species)
  7. 2318630Species Cow (Bos taurus) [TaxId:9913] [140511] (3 PDB entries)
    Uniprot P00514 12-61
  8. 2318635Domain d2ezwb_: 2ezw B: [132646]
    automated match to d3im3a_

Details for d2ezwb_

PDB Entry: 2ezw (more details)

PDB Description: solution structure of the docking and dimerization domain of the type i alpha regulatory subunit of protein kinase a (rialpha d/d)
PDB Compounds: (B:) cAMP-dependent protein kinase type I-alpha regulatory subunit

SCOPe Domain Sequences for d2ezwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezwb_ a.31.1.1 (B:) cAMP-dependent protein kinase type I-alpha regulatory subunit {Cow (Bos taurus) [TaxId: 9913]}
slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeeak

SCOPe Domain Coordinates for d2ezwb_:

Click to download the PDB-style file with coordinates for d2ezwb_.
(The format of our PDB-style files is described here.)

Timeline for d2ezwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ezwa1