SCOP 1.73: Domain d2eyqb5: 2eyq B:779-989

Lineage for d2eyqb5 (2eyq B:779-989)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (22 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Transcription-repair coupling factor, TRCF [142320] (1 species)
   similar to UvrB in the N-terminal part and DEAD helicases in the C-terminal part; also contains CarD-like domain in the middle and TRCF domain at the C-terminus

7. Species Escherichia coli [TaxId:562] [142321] (2 PDB entries)

8. Domain d2eyqb5: 2eyq B:779-989 [132600]
   Other proteins in same PDB: d2eyqa1, d2eyqa6, d2eyqb1, d2eyqb6
   automatically matched to 2EYQ A:779-989
   complexed with epe, so4

Details for d2eyqb5

PDB Entry: 2eyq, 3.2 Å

PDB Description: Crystal structure of Escherichia coli transcription-repair coupling factor

PDB Compounds: (B:) Transcription-repair coupling factor

SCOP Domain Sequences for d2eyqb5:

Sequence; same for both SEQRES and ATOM records:

>d2eyqb5 c.37.1.19 (B:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}
pparrlavktfvreydsmvvreailreilrggqvyylyndveniqkaaerlaelvpeari
aighgqmrerelervmndfhhqrfnvlvcttiietgidiptantiiieradhfglaqlhq
lrgrvgrshhqayawlltphpkamttdaqkrleaiasledlgagfalathdleirgagel
lgeeqsgsmetigfslymellenavdalkag

Timeline for d2eyqb5:

• d2eyqb5 is new in SCOP 1.73
  
• d2eyqb5 appears in SCOP 1.75
  
• d2eyqb5 appears in the current release, SCOPe 2.08