Lineage for d2eyqb5 (2eyq B:779-989)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. Protein Transcription-repair coupling factor TRCF, domain 4 [418977] (1 species)
    entire protein is similar to UvrB in the N-terminal part and DEAD helicases in the C-terminal part; also contains CarD-like domain in the middle and TRCF domain at the C-terminus
  7. Species Escherichia coli [TaxId:562] [419441] (1 PDB entry)
    Uniprot P30958
  8. Domain d2eyqb5: 2eyq B:779-989 [132600]
    Other proteins in same PDB: d2eyqa1, d2eyqa2, d2eyqa3, d2eyqa4, d2eyqa6, d2eyqb1, d2eyqb2, d2eyqb3, d2eyqb4, d2eyqb6
    automatically matched to 2EYQ A:779-989
    complexed with epe, so4

    has additional insertions and/or extensions that are not grouped together

Details for d2eyqb5

PDB Entry: 2eyq (more details), 3.2 Å

PDB Description: Crystal structure of Escherichia coli transcription-repair coupling factor
PDB Compounds: (B:) Transcription-repair coupling factor

SCOPe Domain Sequences for d2eyqb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eyqb5 c.37.1.19 (B:779-989) Transcription-repair coupling factor TRCF, domain 4 {Escherichia coli [TaxId: 562]}
pparrlavktfvreydsmvvreailreilrggqvyylyndveniqkaaerlaelvpeari
aighgqmrerelervmndfhhqrfnvlvcttiietgidiptantiiieradhfglaqlhq
lrgrvgrshhqayawlltphpkamttdaqkrleaiasledlgagfalathdleirgagel
lgeeqsgsmetigfslymellenavdalkag

SCOPe Domain Coordinates for d2eyqb5 are not available.

Timeline for d2eyqb5:

View in 3D
Domains from same chain:
(mouse over for more information)
d2eyqb1, d2eyqb2, d2eyqb3, d2eyqb4, d2eyqb6
View in 3D
Domains from other chains:
(mouse over for more information)
d2eyqa1, d2eyqa2, d2eyqa3, d2eyqa4, d2eyqa5, d2eyqa6