Lineage for d2eyqa6 (2eyq A:990-1147)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741744Fold d.315: TRCF domain-like [143516] (1 superfamily)
    beta-alpha(3)-beta(2)-alpha-beta(2)-alpha; 2 layers: alpha/beta; mixed beta sheet, order 12354, strands 1 and 2 are parallel; some topological similarity to the DCoH-like fold (scop_cf 55247)
  4. 741745Superfamily d.315.1: TRCF domain-like [143517] (1 family) (S)
  5. 741746Family d.315.1.1: TRCF domain [143518] (1 protein)
    Pfam PF03461
  6. 741747Protein Transcription-repair coupling factor, TRCF, C-terminal domain [143519] (1 species)
  7. 741748Species Escherichia coli [TaxId:562] [143520] (1 PDB entry)
  8. 741749Domain d2eyqa6: 2eyq A:990-1147 [132595]
    Other proteins in same PDB: d2eyqa1, d2eyqa2, d2eyqa3, d2eyqa4, d2eyqa5, d2eyqb1, d2eyqb2, d2eyqb3, d2eyqb4, d2eyqb5
    complexed with epe, so4

Details for d2eyqa6

PDB Entry: 2eyq (more details), 3.2 Å

PDB Description: Crystal structure of Escherichia coli transcription-repair coupling factor
PDB Compounds: (A:) Transcription-repair coupling factor

SCOP Domain Sequences for d2eyqa6:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eyqa6 d.315.1.1 (A:990-1147) Transcription-repair coupling factor, TRCF, C-terminal domain {Escherichia coli [TaxId: 562]}
repsledltsqqtevelrmpsllpddfipdvntrlsfykriasakteneleeikvelidr
fgllpdpartlldiarlrqqaqklgirklegnekggviefaeknhvnpawligllqkqpq
hyrldgptrlkfiqdlserktriewvrqfmreleenai

SCOP Domain Coordinates for d2eyqa6:

Click to download the PDB-style file with coordinates for d2eyqa6.
(The format of our PDB-style files is described here.)

Timeline for d2eyqa6: