![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.315: TRCF domain-like [143516] (1 superfamily) beta-alpha(3)-beta(2)-alpha-beta(2)-alpha; 2 layers: alpha/beta; mixed beta sheet, order 12354, strands 1 and 2 are parallel; some topological similarity to the DCoH-like fold (55247) |
![]() | Superfamily d.315.1: TRCF domain-like [143517] (1 family) ![]() |
![]() | Family d.315.1.1: TRCF domain [143518] (1 protein) Pfam PF03461 |
![]() | Protein Transcription-repair coupling factor, TRCF, C-terminal domain [143519] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [143520] (1 PDB entry) Uniprot P30958 990-1147 |
![]() | Domain d2eyqa6: 2eyq A:990-1147 [132595] Other proteins in same PDB: d2eyqa1, d2eyqa2, d2eyqa3, d2eyqa4, d2eyqa5, d2eyqb1, d2eyqb2, d2eyqb3, d2eyqb4, d2eyqb5 complexed with epe, so4 |
PDB Entry: 2eyq (more details), 3.2 Å
SCOPe Domain Sequences for d2eyqa6:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eyqa6 d.315.1.1 (A:990-1147) Transcription-repair coupling factor, TRCF, C-terminal domain {Escherichia coli [TaxId: 562]} repsledltsqqtevelrmpsllpddfipdvntrlsfykriasakteneleeikvelidr fgllpdpartlldiarlrqqaqklgirklegnekggviefaeknhvnpawligllqkqpq hyrldgptrlkfiqdlserktriewvrqfmreleenai
Timeline for d2eyqa6: