Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) the active site is the most conserved structural region of the superfamily and is located between the subdomains |
Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins) contains C-terminal PUA domain |
Protein Pseudouridine synthase II TruB [69747] (5 species) |
Species Pyrococcus furiosus [TaxId:2261] [143434] (2 PDB entries) Uniprot Q7LWY0 5-249 |
Domain d2ey4b2: 2ey4 B:11-252 [132581] Other proteins in same PDB: d2ey4a1, d2ey4b1, d2ey4c1, d2ey4d_, d2ey4e1, d2ey4f_ automated match to d2ey4a2 complexed with zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2ey4 (more details), 2.11 Å
SCOPe Domain Sequences for d2ey4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ey4b2 d.265.1.2 (B:11-252) Pseudouridine synthase II TruB {Pyrococcus furiosus [TaxId: 2261]} rilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevvawik kilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedkiiq vmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirslihhi glalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpmekav eh
Timeline for d2ey4b2: