Lineage for d2ey4b2 (2ey4 B:11-252)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741101Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 741102Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 741117Family d.265.1.2: Pseudouridine synthase II TruB [69746] (1 protein)
    contains C-terminal PUA domain
  6. 741118Protein Pseudouridine synthase II TruB [69747] (5 species)
  7. 741121Species Archaeon Pyrococcus furiosus [TaxId:2261] [143434] (2 PDB entries)
  8. 741123Domain d2ey4b2: 2ey4 B:11-252 [132581]
    Other proteins in same PDB: d2ey4a1, d2ey4b1, d2ey4c1, d2ey4d1, d2ey4e1, d2ey4f1
    automatically matched to 2EY4 A:8-252
    complexed with zn

Details for d2ey4b2

PDB Entry: 2ey4 (more details), 2.11 Å

PDB Description: crystal structure of a cbf5-nop10-gar1 complex
PDB Compounds: (B:) Probable tRNA pseudouridine synthase B

SCOP Domain Sequences for d2ey4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ey4b2 d.265.1.2 (B:11-252) Pseudouridine synthase II TruB {Archaeon Pyrococcus furiosus [TaxId: 2261]}
rilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevvawik
kilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedkiiq
vmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirslihhi
glalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpmekav
eh

SCOP Domain Coordinates for d2ey4b2:

Click to download the PDB-style file with coordinates for d2ey4b2.
(The format of our PDB-style files is described here.)

Timeline for d2ey4b2: