SCOPe 2.08: Domain d2ey4b1: 2ey4 B:253-336

Lineage for d2ey4b1 (2ey4 B:253-336)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.1: PUA domain [88698] (6 proteins)
   RNA-binding domain

6. Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species)

7. Species Pyrococcus furiosus [TaxId:2261] [141699] (2 PDB entries)
   Uniprot Q7LWY0 250-333

8. Domain d2ey4b1: 2ey4 B:253-336 [132580]
   Other proteins in same PDB: d2ey4a2, d2ey4b2, d2ey4c1, d2ey4d_, d2ey4e1, d2ey4f_
   automated match to d2ey4a1
   complexed with zn

Details for d2ey4b1

PDB Entry: 2ey4, 2.11 Å

PDB Description: crystal structure of a cbf5-nop10-gar1 complex

PDB Compounds: (B:) Probable tRNA pseudouridine synthase B

SCOPe Domain Sequences for d2ey4b1:

Sequence; same for both SEQRES and ATOM records:

>d2ey4b1 b.122.1.1 (B:253-336) Pseudouridine synthase II TruB, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
lpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsqem
lektkgiavdvekvfmprdwypkl

Timeline for d2ey4b1:

• d2ey4b1 first appeared in SCOP 1.73
  
• d2ey4b1 appears in SCOPe 2.07