SCOPe 2.08: Domain d2ey4f_: 2ey4 F:

Lineage for d2ey4f_ (2ey4 F:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family)
   automatically mapped to Pfam PF04135

5. Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
   Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)

6. Protein automated matches [190486] (2 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [187680] (2 PDB entries)

8. Domain d2ey4f_: 2ey4 F: [132585]
   Other proteins in same PDB: d2ey4a1, d2ey4a2, d2ey4b1, d2ey4b2, d2ey4c1, d2ey4d_, d2ey4e1
   automated match to d2hvyc1
   complexed with zn

Details for d2ey4f_

PDB Entry: 2ey4, 2.11 Å

PDB Description: crystal structure of a cbf5-nop10-gar1 complex

PDB Compounds: (F:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d2ey4f_:

Sequence; same for both SEQRES and ATOM records:

>d2ey4f_ g.41.16.1 (F:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
rirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi

Timeline for d2ey4f_:

• d2ey4f_ first appeared in SCOP 1.73, called d2ey4f1
  
• d2ey4f_ appears in SCOPe 2.07