SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ex4b2 (2ex4 B:2-224)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130297Family c.66.1.42: AD-003 protein-like [117685] (3 protein domains)
    Pfam PF05891; DUF858
  6. 2130304Protein automated matches [190630] (1 species)
    not a true protein
  7. 2130305Species Human (Homo sapiens) [TaxId:9606] [187677] (2 PDB entries)
  8. 2130308Domain d2ex4b2: 2ex4 B:2-224 [132517]
    Other proteins in same PDB: d2ex4a1, d2ex4a2, d2ex4b3
    automated match to d2ex4a1
    complexed with sah

Details for d2ex4b2

PDB Entry: 2ex4 (more details), 1.75 Å

PDB Description: Crystal Structure of Human methyltransferase AD-003 in complex with S-adenosyl-L-homocysteine
PDB Compounds: (B:) adrenal gland protein AD-003

SCOPe Domain Sequences for d2ex4b2:

Sequence, based on SEQRES records: (download)

>d2ex4b2 c.66.1.42 (B:2-224) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tseviedekqfyskaktywkqipptvdgmlggyghissidinssrkflqrflregpnktg
tscaldcgagigritkrlllplfrevdmvditedflvqaktylgeegkrvrnyfccglqd
ftpepdsydviwiqwvighltdqhlaeflrrckgslrpngiivikdnmaqegvilddvds
svcrdldvvrriicsaglsllaeerqenlpdeiyhvysfalr

Sequence, based on observed residues (ATOM records): (download)

>d2ex4b2 c.66.1.42 (B:2-224) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tseviedekqfyskaktywkqipptvdgmlggyghissidinssrkflqrflrktgtsca
ldcgagigritkrlllplfrevdmvditedflvqaktylgeegkrvrnyfccglqdftpe
pdsydviwiqwvighltdqhlaeflrrckgslrpngiivikdnmaqegvilddvdssvcr
dldvvrriicsaglsllaeerqenlpdeiyhvysfalr

SCOPe Domain Coordinates for d2ex4b2:

Click to download the PDB-style file with coordinates for d2ex4b2.
(The format of our PDB-style files is described here.)

Timeline for d2ex4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ex4b3