Lineage for d2ex4a1 (2ex4 A:2-224)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894055Family c.66.1.42: AD-003 protein-like [117685] (3 proteins)
    Pfam PF05891; DUF858
  6. 2894056Protein Adrenal gland protein AD-003 (C9orf32) [142597] (1 species)
  7. 2894057Species Human (Homo sapiens) [TaxId:9606] [142598] (1 PDB entry)
    Uniprot Q9BV86 1-222
  8. 2894058Domain d2ex4a1: 2ex4 A:2-224 [132516]
    Other proteins in same PDB: d2ex4a2, d2ex4b2, d2ex4b3
    complexed with sah

Details for d2ex4a1

PDB Entry: 2ex4 (more details), 1.75 Å

PDB Description: Crystal Structure of Human methyltransferase AD-003 in complex with S-adenosyl-L-homocysteine
PDB Compounds: (A:) adrenal gland protein AD-003

SCOPe Domain Sequences for d2ex4a1:

Sequence, based on SEQRES records: (download)

>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]}
tseviedekqfyskaktywkqipptvdgmlggyghissidinssrkflqrflregpnktg
tscaldcgagigritkrlllplfrevdmvditedflvqaktylgeegkrvrnyfccglqd
ftpepdsydviwiqwvighltdqhlaeflrrckgslrpngiivikdnmaqegvilddvds
svcrdldvvrriicsaglsllaeerqenlpdeiyhvysfalr

Sequence, based on observed residues (ATOM records): (download)

>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]}
tseviedekqfyskaktywkqipptvdgmlggyghissidinssrkflqrflrktgtsca
ldcgagigritkrlllplfrevdmvditedflvqaktylgeegkrvrnyfccglqdftpe
pdsydviwiqwvighltdqhlaeflrrckgslrpngiivikdnmaqegvilddvdssvcr
dldvvrriicsaglsllaeerqenlpdeiyhvysfalr

SCOPe Domain Coordinates for d2ex4a1:

Click to download the PDB-style file with coordinates for d2ex4a1.
(The format of our PDB-style files is described here.)

Timeline for d2ex4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ex4a2