Lineage for d2ex4b2 (2ex4 B:2-224)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501758Family c.66.1.42: AD-003 protein-like [117685] (3 proteins)
    Pfam PF05891; DUF858
  6. 2501765Protein automated matches [190630] (1 species)
    not a true protein
  7. 2501766Species Human (Homo sapiens) [TaxId:9606] [187677] (2 PDB entries)
  8. 2501769Domain d2ex4b2: 2ex4 B:2-224 [132517]
    Other proteins in same PDB: d2ex4a1, d2ex4a2, d2ex4b3
    automated match to d2ex4a1
    complexed with sah

Details for d2ex4b2

PDB Entry: 2ex4 (more details), 1.75 Å

PDB Description: Crystal Structure of Human methyltransferase AD-003 in complex with S-adenosyl-L-homocysteine
PDB Compounds: (B:) adrenal gland protein AD-003

SCOPe Domain Sequences for d2ex4b2:

Sequence, based on SEQRES records: (download)

>d2ex4b2 c.66.1.42 (B:2-224) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tseviedekqfyskaktywkqipptvdgmlggyghissidinssrkflqrflregpnktg
tscaldcgagigritkrlllplfrevdmvditedflvqaktylgeegkrvrnyfccglqd
ftpepdsydviwiqwvighltdqhlaeflrrckgslrpngiivikdnmaqegvilddvds
svcrdldvvrriicsaglsllaeerqenlpdeiyhvysfalr

Sequence, based on observed residues (ATOM records): (download)

>d2ex4b2 c.66.1.42 (B:2-224) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tseviedekqfyskaktywkqipptvdgmlggyghissidinssrkflqrflrktgtsca
ldcgagigritkrlllplfrevdmvditedflvqaktylgeegkrvrnyfccglqdftpe
pdsydviwiqwvighltdqhlaeflrrckgslrpngiivikdnmaqegvilddvdssvcr
dldvvrriicsaglsllaeerqenlpdeiyhvysfalr

SCOPe Domain Coordinates for d2ex4b2:

Click to download the PDB-style file with coordinates for d2ex4b2.
(The format of our PDB-style files is described here.)

Timeline for d2ex4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ex4b3