SCOP 1.75: Domain d2einu1: 2ein U:7-85

Lineage for d2einu1 (2ein U:7-85)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)

6. Protein Cytochrome c oxidase subunit h [47696] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47697] (14 PDB entries)

8. Domain d2einu1: 2ein U:7-85 [132273]
   Other proteins in same PDB: d2eina1, d2einb1, d2einb2, d2einc1, d2eind1, d2eine1, d2einf1, d2eing1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2einn1, d2eino1, d2eino2, d2einp1, d2einq1, d2einr1, d2eins1, d2eint1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1
   automatically matched to d1ocrh_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2einu1

PDB Entry: 2ein, 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state

PDB Compounds: (U:) Cytochrome c oxidase subunit VIb isoform 1

SCOP Domain Sequences for d2einu1:

Sequence; same for both SEQRES and ATOM records:

>d2einu1 a.51.1.1 (U:7-85) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

Timeline for d2einu1:

• d2einu1 first appeared in SCOP 1.73
  
• d2einu1 is called d2einu_ in SCOPe 2.01
  
• d2einu1 appears in the current release, SCOPe 2.08, called d2einu_