Lineage for d2eing1 (2ein G:1-84)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887161Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
  5. 887162Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (1 protein)
  6. 887163Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 887164Species Cow (Bos taurus) [TaxId:9913] [81408] (14 PDB entries)
  8. 887185Domain d2eing1: 2ein G:1-84 [132258]
    Other proteins in same PDB: d2eina1, d2einb1, d2einb2, d2einc1, d2eind1, d2eine1, d2einf1, d2einh1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2einn1, d2eino1, d2eino2, d2einp1, d2einq1, d2einr1, d2eins1, d2einu1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1
    automatically matched to d1occg_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eing1

PDB Entry: 2ein (more details), 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (G:) Cytochrome c oxidase polypeptide VIa-heart

SCOP Domain Sequences for d2eing1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eing1 f.23.2.1 (G:1-84) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOP Domain Coordinates for d2eing1:

Click to download the PDB-style file with coordinates for d2eing1.
(The format of our PDB-style files is described here.)

Timeline for d2eing1: