![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) ![]() |
![]() | Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81454] (14 PDB entries) |
![]() | Domain d2eino2: 2ein O:1-90 [132267] Other proteins in same PDB: d2eina1, d2einb1, d2einc1, d2eind1, d2eine1, d2einf1, d2eing1, d2einh1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2einn1, d2eino1, d2einp1, d2einq1, d2einr1, d2eins1, d2eint1, d2einu1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1 automatically matched to d1occb2 complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2ein (more details), 2.7 Å
SCOP Domain Sequences for d2eino2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eino2 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]} maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe vetiwtilpaiililialpslrilymmdei
Timeline for d2eino2:
![]() Domains from other chains: (mouse over for more information) d2eina1, d2einb1, d2einb2, d2einc1, d2eind1, d2eine1, d2einf1, d2eing1, d2einh1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2einn1, d2einp1, d2einq1, d2einr1, d2eins1, d2eint1, d2einu1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1 |