SCOP 1.75: Domain d2eint1: 2ein T:1-84

Lineage for d2eint1 (2ein T:1-84)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
   probably responsible for the dimerization of the mitochondrial cytochrome c oxidase

7. Species Cow (Bos taurus) [TaxId:9913] [81408] (14 PDB entries)

8. Domain d2eint1: 2ein T:1-84 [132272]
   Other proteins in same PDB: d2eina1, d2einb1, d2einb2, d2einc1, d2eind1, d2eine1, d2einf1, d2einh1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2einn1, d2eino1, d2eino2, d2einp1, d2einq1, d2einr1, d2eins1, d2einu1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1
   automatically matched to d1occg_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eint1

PDB Entry: 2ein, 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state

PDB Compounds: (T:) Cytochrome c oxidase polypeptide VIa-heart

SCOP Domain Sequences for d2eint1:

Sequence; same for both SEQRES and ATOM records:

>d2eint1 f.23.2.1 (T:1-84) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d2eint1:

• d2eint1 first appeared in SCOP 1.73
  
• d2eint1 is called d2eint_ in SCOPe 2.01
  
• d2eint1 appears in the current release, SCOPe 2.08, called d2eint_