Lineage for d2e7sf_ (2e7s F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040662Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family) (S)
    dimeric coiled coil
  5. 3040663Family h.1.33.1: Sec2 N-terminal region [144285] (2 proteins)
  6. 3040674Protein automated matches [254514] (1 species)
    not a true protein
  7. 3040675Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255133] (1 PDB entry)
  8. 3040680Domain d2e7sf_: 2e7s F: [132073]
    Other proteins in same PDB: d2e7sa1
    automated match to d2e7sg1

Details for d2e7sf_

PDB Entry: 2e7s (more details), 3 Å

PDB Description: crystal structure of the yeast sec2p gef domain
PDB Compounds: (F:) Rab guanine nucleotide exchange factor SEC2

SCOPe Domain Sequences for d2e7sf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e7sf_ h.1.33.1 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlldtltlq
lknl

SCOPe Domain Coordinates for d2e7sf_:

Click to download the PDB-style file with coordinates for d2e7sf_.
(The format of our PDB-style files is described here.)

Timeline for d2e7sf_: