![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family) ![]() dimeric coiled coil |
![]() | Family h.1.33.1: Sec2 N-terminal region [144285] (2 proteins) |
![]() | Protein automated matches [254514] (1 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255133] (1 PDB entry) |
![]() | Domain d2e7sn_: 2e7s N: [132081] Other proteins in same PDB: d2e7sa1 automated match to d2e7sc_ |
PDB Entry: 2e7s (more details), 3 Å
SCOPe Domain Sequences for d2e7sn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e7sn_ h.1.33.1 (N:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekd
Timeline for d2e7sn_: