Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (35 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family) dimeric coiled coil |
Family h.1.33.1: Sec2 N-terminal region [144285] (2 proteins) |
Protein automated matches [254514] (1 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255133] (1 PDB entry) |
Domain d2e7sb_: 2e7s B: [132069] Other proteins in same PDB: d2e7sa1 automated match to d2e7sg1 |
PDB Entry: 2e7s (more details), 3 Å
SCOPe Domain Sequences for d2e7sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e7sb_ h.1.33.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlldtltlq l
Timeline for d2e7sb_: