Lineage for d2e7sg1 (2e7s G:31-140)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1466121Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1467249Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family) (S)
    dimeric coiled coil
  5. 1467250Family h.1.33.1: Sec2 N-terminal region [144285] (1 protein)
  6. 1467251Protein Rab guanine nucleotide exchange factor Sec2 [144286] (1 species)
  7. 1467252Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144287] (3 PDB entries)
    Uniprot P17065 16-162! Uniprot P17065 31-144
  8. 1467261Domain d2e7sg1: 2e7s G:31-140 [132074]
    automatically matched to 2E7S A:31-144

Details for d2e7sg1

PDB Entry: 2e7s (more details), 3 Å

PDB Description: crystal structure of the yeast sec2p gef domain
PDB Compounds: (G:) Rab guanine nucleotide exchange factor SEC2

SCOPe Domain Sequences for d2e7sg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e7sg1 h.1.33.1 (G:31-140) Rab guanine nucleotide exchange factor Sec2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrek

SCOPe Domain Coordinates for d2e7sg1:

Click to download the PDB-style file with coordinates for d2e7sg1.
(The format of our PDB-style files is described here.)

Timeline for d2e7sg1: